DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angpt1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_006241671.1 Gene:Angpt1 / 89807 RGDID:628896 Length:498 Species:Rattus norvegicus


Alignment Length:267 Identity:95/267 - (35%)
Similarity:141/267 - (52%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGINSN 76
            :..|:|...|...:|.|:    ::||........||...:|  ||:...:.   :....||.|.:
  Rat   242 NNNSVLQKQQLELMDTVH----NLVSLCTKEGVLLKGGKRE--EEKPFRDC---ADVYQAGFNKS 297

  Fly    77 GIHVIEVPGL-EPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKL 140
            ||:.|....: ||..|:|:..:.|.||||||.|:|||.:|.|.|:||..|||..|||:::|.|.:
  Rat   298 GIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFI 362

  Fly   141 HFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG--DSLRYHKGMPF 203
            ..:|:...|.|.:.:.|:.|....::|:.|.|||...:|.|.:.| ::|.||  .||..| |..|
  Rat   363 FAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKG-HTGTAGKQSSLILH-GADF 425

  Fly   204 ST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKF 266
            ||  .|:|:....||.:..|.||:|.|..|||||.:...|:...|::  ||.|..::|..|..:.
  Rat   426 STKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLN--GIKWHYFKGPSYSLRS 488

  Fly   267 VQMMIRP 273
            ..|||||
  Rat   489 TTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 83/216 (38%)
Angpt1XP_006241671.1 COG4372 <55..>255 CDD:226809 3/12 (25%)
FReD 281..496 CDD:238040 83/222 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.