DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angpt2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_604449.1 Gene:Angpt2 / 89805 RGDID:621861 Length:496 Species:Rattus norvegicus


Alignment Length:287 Identity:88/287 - (30%)
Similarity:137/287 - (47%) Gaps:39/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSH---ETINP----------------- 65
            |.::|.::..|..|::..|:.:|  :..:......::..|   ||:|.                 
  Rat   212 QKDQLQVLVSKQSSVIDELEKKL--VTATVNNSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVP 274

  Fly    66 ----------SSCLAAGINSNGIHVIEVP-GLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCW 119
                      :....:|:.::||:.:..| ..|....|||..:.|.||||||.|:|||.:|.|.|
  Rat   275 KEEKTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTW 339

  Fly   120 EEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVL 184
            :||.:|||...||:::|.|.:..||:...|.|.:.::|:.|....:.||.|.:....::|.:.:.
  Rat   340 KEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLT 404

  Fly   185 GKYSGDAGD-SLRYHKGMPFSTFDHDDTG--HGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPK 246
            | .:|.||. |.....|..|||.|.|:..  ..|:::..|.||:|.|..|||||||....:...|
  Rat   405 G-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNK 468

  Fly   247 MSGRGITWMSWRGYDYGYKFVQMMIRP 273
            .:  ||.|..|:|..|..|...|||||
  Rat   469 FN--GIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 79/242 (33%)
Angpt2NP_604449.1 Mplasa_alph_rch <78..>232 CDD:275316 5/19 (26%)
FBG 280..494 CDD:214548 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.