DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and FIBCD1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001138578.1 Gene:FIBCD1 / 84929 HGNCID:25922 Length:461 Species:Homo sapiens


Alignment Length:305 Identity:121/305 - (39%)
Similarity:158/305 - (51%) Gaps:44/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVLILSG----GSLLSTAQSNKLDLVYKKAES------MVSSLKIRLE---------------EL 46
            |:.:..|    |..||..||.:..|:...:||      :|:|:...|:               :|
Human   158 CMGLRKGHGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADL 222

  Fly    47 KQSYKEITEERGSHETINPSSC---LAAGINSNGIHVIEVPGLEP--FPVYCDTRLAGSGWTVIQ 106
            :::....|..||......|..|   |.:|...:|::.: .|...|  |.||||.|..|.||||.|
Human   223 QRAPARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSV-FPTHYPAGFQVYCDMRTDGGGWTVFQ 286

  Fly   107 RRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDF-NGVVHDARYEDF 170
            ||:|||.||:|.|:.|..|||.|:||.::||:::|.|||...|||.|.:||| ||..: |||..|
Human   287 RREDGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAY-ARYGSF 350

  Fly   171 AIGNASA-----SYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQC 228
            .:|..|.     .|.|:| ..|||.|||||..|.||.|:|.|.|.  :.:.||..|.|||||..|
Human   351 GVGLFSVDPEEDGYPLTV-ADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNC 414

  Fly   229 QRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..||||||||.|..   .....|:.|.||.|:.|..||.:|.|||
Human   415 HTSNLNGQYLRGAH---ASYADGVEWSSWTGWQYSLKFSEMKIRP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 104/224 (46%)
FIBCD1NP_001138578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238 4/23 (17%)
FReD 241..457 CDD:238040 104/222 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.