DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fgl2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:331 Identity:104/331 - (31%)
Similarity:149/331 - (45%) Gaps:82/331 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETI-------------N 64
            ||:...||:.|::    ::.||.|:.|.   .|||.:.:||...:|..|::             |
  Rat   108 GGNGAETAEDNRV----QELESQVNKLS---SELKNAKEEIQGLQGRLESLQLVNMNNIENYVDN 165

  Fly    65 PSSCLAAGINSNGIHVIEVPGLE--------------------------------------PFPV 91
            ..:.|.:.:||......:.|..|                                      .|.|
  Rat   166 KVANLTSVVNSLDSKCFKCPSQEHNQPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEV 230

  Fly    92 YCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYME 156
            |||....|.||||:|.|.|||.||.|.|::|..|||.|..||::|.:|:|.||.::...|.:.:|
  Rat   231 YCDMETTGGGWTVLQARLDGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLE 295

  Fly   157 DFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRY-----HKGMPFSTFDHDDTGH--- 213
            ||||:...|.|:.|.:.|....|.|. ||.|:|.|||:||:     |....|:|.|.|:..:   
  Rat   296 DFNGLTLYAVYDQFYVANEFLKYRLH-LGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSG 359

  Fly   214 GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--RGITWMSW--------RGYDYGYKFVQ 268
            .|...|...||:|.|..:||||:|     :..:..|  .||.|.:|        .||.:.:|..:
  Rat   360 NCGLYYSSGWWFDACLSANLNGKY-----YHQRYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAK 419

  Fly   269 MMIRPK 274
            ||||||
  Rat   420 MMIRPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 86/279 (31%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 19/75 (25%)
Fibrinogen_C 199..425 CDD:278572 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.