DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Mfap4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001334474.1 Gene:Mfap4 / 76293 MGIID:1342276 Length:281 Species:Mus musculus


Alignment Length:248 Identity:92/248 - (37%)
Similarity:119/248 - (47%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SCL----------AAGINSNGIHVIEVPGLE-PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWE 120
            |||          |.|...:|:::|...|.. |.||:||....|..|||.|:|.:||.:|:|.|.
Mouse    35 SCLQQPLDCDDIYAQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWS 99

  Fly   121 EYSQGFGELSGEFF------------------------MGLEKLHFLTTAEPYELFVYMEDFNGV 161
            :|..|||...||::                        :||:.||.||..:.|||.|.:|||...
Mouse   100 DYKLGFGRADGEYWLGKVGPWGGGCPSAKSLLTGCHPSLGLQNLHLLTLKQKYELRVDLEDFENN 164

  Fly   162 VHDARYEDFAIG-NASAS----YALSVLGKYSGDAGDSLRYHKGMPFSTFDHDDT--GHGCARIY 219
            ...|:|.||:|. ||.::    |.|.|.|...|.|||||.||.|..|||||.|..  ...||.:.
Mouse   165 TAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALS 229

  Fly   220 VGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIR 272
            .||:|:..|..:||||.||.|....   ...||.|..|:|:.|..|..:|.||
Mouse   230 SGAFWFRSCHFANLNGFYLGGSHLS---YANGINWAQWKGFYYSLKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 92/248 (37%)
Mfap4NP_001334474.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.