DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_082609.2 Gene:Angptl1 / 72713 MGIID:1919963 Length:490 Species:Mus musculus


Alignment Length:208 Identity:87/208 - (41%)
Similarity:125/208 - (60%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AGINSNGIHVIEVP---GLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGE 132
            ||.:::||::|:..   ||  ..::|:..|...||||||:|.|||.||:|.||.|.:|||.:.||
Mouse   285 AGHSASGIYMIKPENSNGL--MQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGE 347

  Fly   133 FFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRY 197
            :::||:.::.|:..:.|:|.:.:||::.....|.|..|.:...|..|.|. ||.|.|:||||:.:
Mouse   348 YWLGLDNIYKLSNQDNYKLMIELEDWSEKKVYAEYSSFRLEPESDYYRLR-LGTYQGNAGDSMMW 411

  Fly   198 HKGMPFSTFDHD-DTGHG-CARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGY 260
            |.|..|:|.|.| ||..| ||..:.|.|||:.|..|||||.:..||.:..|... ||.|..:||.
Mouse   412 HNGKQFTTLDRDKDTYTGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQD-GIFWAEYRGG 475

  Fly   261 DYGYKFVQMMIRP 273
            .|..:.|||||:|
Mouse   476 SYSLRAVQMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/208 (42%)
Angptl1NP_082609.2 RILP-like 91..207 CDD:304877
FReD 274..489 CDD:238040 87/208 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.