DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and TNR

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:293 Identity:102/293 - (34%)
Similarity:144/293 - (49%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVYKKAESMVSSL-------KIRLEELKQ--------------SYKEITE---ERGSHETINPSS 67
            |.||..:.....|       .||||.|.:              ::..||.   ..|.....:|..
Human  1073 LTYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQD 1137

  Fly    68 C---LAAGINSNGIHVIEVPG--LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFG 127
            |   |..|...:|::.|.:.|  .:...||||....|.||.|.||||:|..:|:|.|.:|..|||
Human  1138 CAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFG 1202

  Fly   128 ELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG 192
            .:..||::||:.:|.:|:...|||.|.|.|...... |.|:.|::.::...|.|.: |.|:|.||
Human  1203 NVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAF-ASYDRFSVEDSRNLYKLRI-GSYNGTAG 1265

  Fly   193 DSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWM 255
            |||.||:|.||||.|.|:  ....||..|.|||||..|.|:||||:|.|      ....:||.|.
Human  1266 DSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGE------SRHSQGINWY 1324

  Fly   256 SWRGYDYGYKFVQMMIRP---KCSNNLRRQGMQ 285
            .|:|:::...||:|.:||   :.....:||.:|
Human  1325 HWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQ 1357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/220 (40%)
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020 11/53 (21%)
FReD 1133..1342 CDD:238040 85/216 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.