DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl7

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001034643.1 Gene:Angptl7 / 654812 MGIID:3605801 Length:337 Species:Mus musculus


Alignment Length:272 Identity:98/272 - (36%)
Similarity:139/272 - (51%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLSTAQS------NKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGI 73
            |.||||:|      |::|::..:|...|:                  :..:....:.||......
Mouse    84 SRLSTAESKYSEMNNQIDIMQLQAAQTVT------------------QTSADAIYDCSSLYQKNY 130

  Fly    74 NSNGIHVI---EVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFM 135
            ..:|::.:   |..|.....|:||...:|.|||:||||:.|..:||:.|.:|.||||.:.|:|::
Mouse   131 RISGVYKLPPDEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWL 195

  Fly   136 GLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG-DSLRYHK 199
            |.|.:|.| |.:|..|.|.:||:.|....|.|..||:||...||.| .||.|||:.| |:|.||.
Mouse   196 GNEHIHRL-TRQPSRLRVELEDWEGNARYAEYSYFALGNELNSYRL-FLGNYSGNVGKDALLYHN 258

  Fly   200 GMPFSTFDHDDTG--HGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDY 262
            ...|||.|.|:..  ..||::..|.:||:.|..|||||.|...|.....|.  ||:|..|.|.:|
Mouse   259 NTVFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRKHMD--GISWYGWHGANY 321

  Fly   263 GYKFVQMMIRPK 274
            ..|.|:|.|||:
Mouse   322 SLKRVEMKIRPE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/216 (40%)
Angptl7NP_001034643.1 FReD 120..332 CDD:238040 86/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.