DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC594984

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:215 Identity:92/215 - (42%)
Similarity:117/215 - (54%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE 128
            |....|..|.:.:|.:.|..|...|.||:||....|.||.|.|||:|||.:|::.|:.|.:|||.
 Frog   108 NCKEWLDQGASISGWYTIYRPNGLPLPVFCDMETDGGGWIVFQRRKDGSVDFFQEWDSYKRGFGR 172

  Fly   129 LSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGD 193
            ...||::|.|.||.||....::|.|.:.||:.....|.|.:|.||..|.:|.||:.|...|||||
 Frog   173 QDSEFWLGNENLHLLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLSLGGFTGGDAGD 237

  Fly   194 SLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEG--GRFEPKMSGRGITW 254
            ||..||...||:.|.|:...  .||..|.|||||..|..|||||.||.|  |.|     ..|:.|
 Frog   238 SLSGHKNREFSSKDRDNDSSPTSCAERYKGAWWYSGCHTSNLNGLYLGGKHGSF-----ANGVNW 297

  Fly   255 MSWRGYDYGYKFVQMMIRPK 274
            .|..||:|.||..:|..||:
 Frog   298 KSGGGYNYSYKVSEMKFRPQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 91/213 (43%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 90/212 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.