DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fgb

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001107962.1 Gene:fgb / 594921 XenbaseID:XB-GENE-483216 Length:490 Species:Xenopus tropicalis


Alignment Length:222 Identity:84/222 - (37%)
Similarity:113/222 - (50%) Gaps:37/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFG-----------ELSGEFFMGLEKLH 141
            ||.||||......||||||.|||||.||.|.|:.|..|||           ::.||:::|.||:.
 Frog   266 PFKVYCDMATHDGGWTVIQNRQDGSVNFGRTWDSYKSGFGNIAANGGKGICDMPGEYWLGNEKIS 330

  Fly   142 FLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL----------- 195
            .||.....|..:.|||::|....|:|..|.:.|.:..|.|||.| |.|.||::|           
 Frog   331 QLTNLGATEALIEMEDWDGAKVTAQYTGFTVQNEANKYQLSVSG-YKGTAGNALMEGASQLKGEN 394

  Fly   196 ---RYHKGMPFSTFDHDDTG--HG-----CARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGR 250
               ..|.||.|||||.|:.|  |.     |::...|.|||::|..:|.||:|..||.:...|:..
 Frog   395 RTMTIHNGMFFSTFDRDNDGWQHADPNKQCSKEDGGGWWYNRCHAANPNGRYYWGGYYTWDMAKH 459

  Fly   251 ----GITWMSWRGYDYGYKFVQMMIRP 273
                |:.||:|:...|..|.:.:.|||
 Frog   460 GTDDGVVWMNWKDSWYSMKNMCIKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/222 (38%)
fgbNP_001107962.1 Fib_alpha 93..235 CDD:285864
FReD 238..487 CDD:294064 84/222 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.