DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_065606.2 Gene:Angptl4 / 57875 MGIID:1888999 Length:410 Species:Mus musculus


Alignment Length:293 Identity:86/293 - (29%)
Similarity:138/293 - (47%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKA---ESMVSSLKIRLEELKQSYKEITE---ERGSHETIN----PSSCLAAGIN 74
            ||::|:..:::|.   :..:|...:|::.|:.....:..   :.|..:|..    |......|:.
Mouse   115 AQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLT 179

  Fly    75 SNGIHVIEVP----------------------GLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYR 117
            .|..|:...|                      |..||.|.|:....| ||||||||.:||.:|.:
Mouse   180 PNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDG-GWTVIQRRLNGSVDFNQ 243

  Fly   118 CWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAI--GNASASYA 180
            .||.|..|||:..|||::||||:|.:|.....:|.|.::|::|   :|:...|.|  |....:|:
Mouse   244 SWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDG---NAKLLQFPIHLGGEDTAYS 305

  Fly   181 LSVLGKYSGDAGDSLRYHKG--MPFSTFDHDDTGHG---CARIYVGAWWYDQCQRSNLNGQYLEG 240
            |.:....:.:.|.:.....|  :||||:|.|....|   ||:...|.||:..|..|||||||...
Mouse   306 LQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHS 370

  Fly   241 GRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ...:.:...:||.|.:|:|..|..:...::|:|
Mouse   371 IPRQRQERKKGIFWKTWKGRYYPLQATTLLIQP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 77/244 (32%)
Angptl4NP_065606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..101
Fib_alpha <104..133 CDD:285864 4/17 (24%)
FReD 187..404 CDD:238040 73/221 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.