DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and CG41520

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001104019.1 Gene:CG41520 / 5740294 FlyBaseID:FBgn0087011 Length:745 Species:Drosophila melanogaster


Alignment Length:224 Identity:92/224 - (41%)
Similarity:124/224 - (55%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SC---LAAGINSNGIHVIEVPGLEPF--PVYCDTRLAGSGWTVIQRR---QDGSENFYRCWEEYS 123
            ||   |.||:..:|:..:::.|...:  .||||......||||||||   :|..|||.|.|.:|.
  Fly   516 SCVDILNAGMKQSGVFYLQIRGTTYWFLKVYCDQETTDGGWTVIQRRDDFKDSRENFNRDWADYK 580

  Fly   124 QGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYS 188
            .||||.|.:|::|.|.::.||..|.|.|.|.:|||.|....|:|..|.|.:.:..|.|.:.| |.
  Fly   581 NGFGEPSKDFWLGNENIYMLTNNEEYSLRVELEDFEGNKRYAQYSHFKIHSEADYYKLEIDG-YE 644

  Fly   189 GDAGDSLR---Y-HKGMPFSTF--DHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPK- 246
            |:|||||.   | ....||||:  |:|.:...||.:..|.||:..|.| .|||.||.    :|: 
  Fly   645 GNAGDSLNDPWYGSNNSPFSTYNKDNDRSSLNCASMLKGGWWWKSCGR-GLNGLYLH----DPQD 704

  Fly   247 -MSGRGITWMSWRGYDYGYKFVQMMIRPK 274
             .:.:||.|..|||:||..|..:|||||:
  Fly   705 ITARQGIVWFRWRGWDYTLKKSKMMIRPR 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 91/222 (41%)
CG41520NP_001104019.1 FReD 516..733 CDD:238040 91/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25543
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
76.810

Return to query results.
Submit another query.