DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and zgc:194887

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001122234.1 Gene:zgc:194887 / 571819 ZFINID:ZDB-GENE-081022-162 Length:272 Species:Danio rerio


Alignment Length:296 Identity:84/296 - (28%)
Similarity:128/296 - (43%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLCVLILSGGSLLSTAQS--NKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSS 67
            ||||         .|..|  ..|.|::.....::.:|         ..|||  .|..|:....| 
Zfish    11 LLCV---------QTEASPVENLHLLHPDEHKLILNL---------GQKEI--PRDCHDLWQRS- 54

  Fly    68 CLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQR-RQDGSENFYRCWEEYSQGFGELSG 131
               .|...:|::||. ||.....|:|  .:|..||||:|. ..:.|.:|.|.|::|.:|||.|:|
Zfish    55 ---GGEARDGLYVIR-PGGSSIAVFC--AMADGGWTVVQHITVNSSVDFDRSWDDYKRGFGSLTG 113

  Fly   132 EFFMGLEKLHFLTTA-EPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL 195
            ..::|.|.||.||:. |.::|.:.:.|.:.|.....|:...:.:..|.|.|. ||.::|.|.|:|
Zfish   114 NHWLGNEHLHQLTSGPERFKLGIKLVDGDAVTKTGEYDPVMVEDERAQYRLR-LGLFTGTAADAL 177

  Fly   196 R------YHKGMPFSTFDHDDTGH--GCARIYV-----GAWWYDQCQRSNLNGQYLEGGRFEPKM 247
            .      .|....|:|.|.|:..:  .|||:..     |.||||.|..:|||.:.:         
Zfish   178 TADTENYLHDNQRFTTRDRDNDNYYQNCARLEFQGVAGGGWWYDACAGANLNRRNV--------- 233

  Fly   248 SGRGITWMSWRGYDYGYKFVQMMIRPKCSNNLRRQG 283
                |.|......:...|:..||::|.....:.|.|
Zfish   234 ----IYWQKDCNKERMCKYAWMMVKPSEQLKVIRSG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 67/225 (30%)
zgc:194887NP_001122234.1 FReD 44..255 CDD:238040 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.