DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angptl2a

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001025401.1 Gene:angptl2a / 569092 ZFINID:ZDB-GENE-080721-15 Length:525 Species:Danio rerio


Alignment Length:233 Identity:93/233 - (39%)
Similarity:131/233 - (56%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TEERGSH-----ETINP-SSCLAA---GINSNGIHVIEVPGLEP-FPVYCDTRLAGSGWTVIQRR 108
            ||:..:|     :...| ..||.|   |.:::|:.:::...... ..|:||.|....||||||||
Zfish   290 TEQSETHSFSTDKLSGPFKDCLQALEEGHSNSGMFLLKPENTNKLMQVWCDQRHDPGGWTVIQRR 354

  Fly   109 QDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIG 173
            .|||.||:|.||.|.||||.:.||:::|||.:::||....|:|.|.:||::|....|.|..|.:.
Zfish   355 MDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTLEDWSGRKTFAEYASFRLE 419

  Fly   174 NASASYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDD---TGHGCARIYVGAWWYDQCQRSNLNG 235
            ..:..|.:.| |:|.|:||||:.:|.|..|:|.|.|.   ||: ||....|.|||:.|..|||||
Zfish   420 PEADFYKMRV-GRYHGNAGDSMTWHNGKQFTTLDRDHDAYTGN-CAHYQKGGWWYNACAHSNLNG 482

  Fly   236 QYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            .:..||.:..:... |:.|..:||..|..|.|.|||||
Zfish   483 VWYRGGHYRSRYQD-GVYWAEFRGGSYSLKKVTMMIRP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 90/219 (41%)
angptl2aNP_001025401.1 DUF1875 <50..>147 CDD:286100
Fib_alpha 119..215 CDD:285864
FReD 305..519 CDD:238040 88/216 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.