DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fibcd1b

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:277 Identity:108/277 - (38%)
Similarity:154/277 - (55%) Gaps:24/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSTAQSNKLDLVYKKAESM------VSSLKIRLE-ELKQSYKEITEERGSHETINPSSC---LA 70
            |||.:|.|.:.:|...::::      ...||.|:: :|:::.......:|......|..|   .|
Zfish   213 LLSESQINMVKVVNSVSDALNAMQKETGGLKARVKADLQRAPVRGVRLKGCANGSRPRDCSDIYA 277

  Fly    71 AGINSNGIHVIEVPGLEP--FPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEF 133
            :|...:||:.: .|...|  |.||||....|.||||||||:|||.||:|.|:.|.:|||:::||:
Zfish   278 SGQREDGIYSV-FPTHYPAGFQVYCDMSTDGGGWTVIQRREDGSVNFFREWDSYREGFGKITGEY 341

  Fly   134 FMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASA-----SYALSVLGKYSGDAGD 193
            ::||:::|.|:....|||.:.:|||......|:|..|.:|..|.     .|.|:: ..|:|.|||
Zfish   342 WLGLKQIHALSIQGNYELRIDLEDFENSTAFAQYGVFGVGLFSVDPEDDGYPLTI-ADYTGTAGD 405

  Fly   194 SLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMS 256
            ||..|.||.|:|.|.|:  :.:.||..|.|||||..|..||||||||.|   :......||.|.|
Zfish   406 SLLKHNGMKFTTKDRDNDHSENNCASFYHGAWWYRNCHTSNLNGQYLRG---QHTSYADGIEWSS 467

  Fly   257 WRGYDYGYKFVQMMIRP 273
            |.|:.|..||.:|.|||
Zfish   468 WTGWQYSLKFTEMKIRP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 97/223 (43%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 95/219 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 183 1.000 Inparanoid score I3957
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.