DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fgl1b

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_017213536.1 Gene:fgl1b / 563523 ZFINID:ZDB-GENE-130530-668 Length:348 Species:Danio rerio


Alignment Length:318 Identity:95/318 - (29%)
Similarity:140/318 - (44%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YLLCVLILSGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSY------------KEITEE 56
            :.|.:|..|.|....:.:.:||     |.|..:.:.|:.:.|.|..:            .|:.|.
Zfish    24 HALTLLQASAGEECQSYEMSKL-----KEEIRMLNNKLLIGEWKVMHLRTHRKFRLVPNLELQEN 83

  Fly    57 RGSHETINPSSCLAAGINSNGIH-------------------VIEVPGLEPFPVYCDTRLAGSGW 102
            :.|.....||..|.:...|..:|                   :...|.||||.||||.. .|..|
Zfish    84 KPSENNTEPSPTLPSTGGSLLVHDKDCSELYDRLKPVSGFYRIKPKPLLEPFLVYCDMD-DGGAW 147

  Fly   103 TVIQRRQDGSENFYRCWEEYSQGFGELSG---EFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHD 164
            ||||:|.:|..:|.|.||:|..|||....   ||::|.:.:|.|.:.....:.:.:.|:.|....
Zfish   148 TVIQKRINGKVDFDRKWEDYKNGFGNFQSSKDEFWLGNDHIHVLLSDGDSVMKIDLTDWKGGKSY 212

  Fly   165 ARYEDFAIGNASASYALSVLGKYSGDAGDSL-----------RYHKGMPFSTFDHDDTGH---GC 215
            |.|::|.:.:....|.| ..|.|||.|||:|           ..|.||.|||.|.|...:   .|
Zfish   213 AMYDNFKVSDEKDKYRL-YYGMYSGQAGDALSGGANMVEQWSASHNGMQFSTRDQDHDRYLQGSC 276

  Fly   216 ARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            |....|.|||::|..:||||::..||.::.|.. .||.|.:|:|..|..:...|.:||
Zfish   277 AAENKGGWWYNRCHAANLNGRFYRGGEYKAKYD-NGIVWSTWKGLWYSLRHTVMKVRP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 81/247 (33%)
fgl1bXP_017213536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.