DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and MGC107908

DIOPT Version :10

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001015738.1 Gene:MGC107908 / 548455 XenbaseID:XB-GENE-29099135 Length:319 Species:Xenopus tropicalis


Alignment Length:214 Identity:89/214 - (41%)
Similarity:112/214 - (52%) Gaps:6/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE 128
            |....|..|...:|.:.|..|...|..|.||....|.||.|.|||.|||.:|||.|..|.:|||.
 Frog   108 NCKEWLDQGGTISGWYTIYTPYGLPLSVLCDMETDGGGWIVFQRRADGSVDFYRDWNSYKRGFGR 172

  Fly   129 LSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGD 193
            ...||::|.:.||.||....::|.|.:.||:.....|.|.:|.|...:.:|.||:.|...|||||
 Frog   173 KESEFWLGNDNLHLLTATGNFQLRVDLTDFSEQRTYAAYSNFRIAGEAQNYTLSLGGFTGGDAGD 237

  Fly   194 SLRYHKGMPFSTFDHDDTGH---GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWM 255
            ||..||..||||.|.|:..|   .||:.|.|||||.:|..|||||.||.|..   .....|:.|.
 Frog   238 SLSGHKNYPFSTKDRDNDIHLTASCAQTYKGAWWYTKCHSSNLNGLYLRGNH---TSYANGVNWG 299

  Fly   256 SWRGYDYGYKFVQMMIRPK 274
            :.:|..|.||..:|..||:
 Frog   300 ASKGIHYSYKVSEMKFRPQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 88/212 (42%)
MGC107908NP_001015738.1 gly_rich_SclB <41..>103 CDD:468478
FReD 107..317 CDD:238040 87/211 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.