DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fcn2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:187 Identity:76/187 - (40%)
Similarity:100/187 - (53%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYEL 151
            :|..|.||....|.||.|.|||.|||.||.|.|..|..|||....||::|.|.|:.||::..:||
 Frog   127 QPMKVLCDMHTDGGGWIVFQRRWDGSVNFNRDWNSYKTGFGNRLNEFWLGNENLYELTSSGTWEL 191

  Fly   152 FVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDDTGHGCA 216
            .:.::||..|.:...|..|.:...:..|.|.:.....|:.|:|:..|..|||||.|:|.:...|.
 Frog   192 RIELQDFENVNYFVIYSSFKLLGEADKYKLLLGNLKEGNIGNSMDVHVNMPFSTLDNDVSPGKCV 256

  Fly   217 RIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..|.|.|||:.|..:||||.||.|   :......||.|.|.:||.|.||..:|.|||
 Frog   257 AKYKGGWWYNDCHHANLNGPYLPG---QHSSYADGINWASGKGYHYSYKHSEMKIRP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 76/187 (41%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 76/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.