DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ANGPTL4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_005272541.1 Gene:ANGPTL4 / 51129 HGNCID:16039 Length:424 Species:Homo sapiens


Alignment Length:311 Identity:88/311 - (28%)
Similarity:134/311 - (43%) Gaps:61/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESMVSSLK---IRLEELKQSYKEITEERGSHETINPS--------------- 66
            ||::::..::.|.......|:   :|::.|:..:..:..:...||...|:               
Human   111 AQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPA 175

  Fly    67 -----------SC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYR 117
                       .|   ...|...:|:..|:..|..||.|.|.....| ||||||||.|||.:|.|
Human   176 HNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDG-GWTVIQRRHDGSVDFNR 239

  Fly   118 CWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAI--GNASASYA 180
            .||.|..|||:..|||::||||:|.:|......|.|.:.|::|   :|....|::  |....:|:
Human   240 PWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDG---NAELLQFSVHLGGEDTAYS 301

  Fly   181 LSVLGKYSGDAGDSLRYHKGM--PFSTFDHDD---TGHGCARIY------------------VGA 222
            |.:....:|..|.:.....|:  ||||:|.|.   ....||:..                  .|.
Human   302 LQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVPSPLTPAGG 366

  Fly   223 WWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ||:..|..|||||||......:.:...:||.|.:|||..|..:...|:|:|
Human   367 WWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 80/265 (30%)
ANGPTL4XP_005272541.1 FReD 183..418 CDD:238040 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.