DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angptl2b

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001119950.1 Gene:angptl2b / 503514 ZFINID:ZDB-GENE-050624-1 Length:519 Species:Danio rerio


Alignment Length:230 Identity:96/230 - (41%)
Similarity:130/230 - (56%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GSHE---TINPS----SCLAA---GINSNGIHVIEVPGLEP-FPVYCDTRLAGSGWTVIQRRQDG 111
            |:|.   |..||    .||.|   |..::|:|:::...... ..|:||.|....||||||||.||
Zfish   287 GTHSPSTTNKPSGPWKDCLEALEDGHTNSGMHLVKPDNTNKLMQVWCDQRQDPGGWTVIQRRMDG 351

  Fly   112 SENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNAS 176
            |.||:|.||.|.||||.:.||:::|||.::::|....|:|.|.:||::|....|.|..|.:...:
Zfish   352 SVNFFRNWETYKQGFGNIDGEYWLGLENIYWITNQGNYKLLVTLEDWSGRKTFAEYASFRLEPEA 416

  Fly   177 ASYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDD---TGHGCARIYVGAWWYDQCQRSNLNGQYL 238
            ..|.|.| |:|.|:|||||.:|.|..|:|.|.|.   ||: ||....|.|||:.|..|||||.:.
Zfish   417 DFYRLRV-GRYHGNAGDSLTWHNGKQFTTLDRDHDVYTGN-CAHYQKGGWWYNACAHSNLNGVWY 479

  Fly   239 EGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            .||.:..:... |:.|..:||..|..|.|.|||||
Zfish   480 RGGHYRSRYQD-GVYWAEFRGGAYSLKKVVMMIRP 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 93/222 (42%)
angptl2bNP_001119950.1 RILP-like 98..216 CDD:304877
FReD 299..513 CDD:238040 89/216 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.