DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angptl7

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001006073.1 Gene:angptl7 / 450053 ZFINID:ZDB-GENE-041010-175 Length:338 Species:Danio rerio


Alignment Length:298 Identity:95/298 - (31%)
Similarity:138/298 - (46%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNKLDLVYKKAESMVSSL---KIRLEELKQSYK-EITEERGSHETINPSSCLAAGINSNGIHVIE 82
            |:.|:.:.||.||.:..:   .:.||:|.|..: .:||....:..|           .|.|.:::
Zfish    52 SSMLEELNKKQESELMKVVRQMMELEKLNQQQEARVTEAESKYSEI-----------YNQIEIMQ 105

  Fly    83 VPGLEPFP---------------------------------------VYCDTRLAGSGWTVIQRR 108
            :...:..|                                       |:||....|.|||:||||
Zfish   106 LQAAQSAPQQSTSDAIYDCASLYNKNYKISGEYKLPKDDFLGTPELNVFCDMENNGGGWTLIQRR 170

  Fly   109 QDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIG 173
            :.|..:|.|.|::|..|||.:.|:|::|.|.: |..|.:|..|.:.|||:.|.|..|.|..|.:.
Zfish   171 KIGLTSFNRDWKQYKNGFGTIRGDFWLGNEHI-FRMTRQPTVLRIEMEDWEGDVRYAEYGFFTLS 234

  Fly   174 NASASYALSVLGKYSGDAGDSLRYHKGMPFST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQ 236
            |...||.| ::..|||:||||||||....|||  .|:|.....||::..|.:||:.|..|||||.
Zfish   235 NEMNSYKL-LIANYSGNAGDSLRYHNNTNFSTKNKDNDKCLDNCAQLRQGGYWYNCCTDSNLNGV 298

  Fly   237 YLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRPK 274
            :...|.......  ||:|..|.|.:|..|.|:|.|||:
Zfish   299 FYRYGSHTKNPD--GISWYGWHGPNYSLKRVEMKIRPQ 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 82/251 (33%)
angptl7NP_001006073.1 FReD 122..333 CDD:238040 77/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.