DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and MFAP4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:219 Identity:90/219 - (41%)
Similarity:117/219 - (53%) Gaps:14/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSC---LAAGINSNGIHVIEVPGLE-PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQG 125
            |..|   .|.|..|:|:::|...|.. |.||:||....|..|||.|:|.:||.:|:|.|.:|..|
Human    62 PLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLG 126

  Fly   126 FGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASAS-----YALSVLG 185
            ||...||:::||:.:|.||..:.|||.|.:|||......|:|.||:|...:.|     |.|.|.|
Human   127 FGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAG 191

  Fly   186 KYSGDAGDSLRYHKGMPFSTFDHDDT--GHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMS 248
            ...|.|||||.||.|..|||||.|..  ...||.:..||:|:..|..:||||.||.|....   .
Human   192 FEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLS---Y 253

  Fly   249 GRGITWMSWRGYDYGYKFVQMMIR 272
            ..||.|..|:|:.|..|..:|.||
Human   254 ANGINWAQWKGFYYSLKRTEMKIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 90/219 (41%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 90/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.