DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and CG9593

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster


Alignment Length:375 Identity:106/375 - (28%)
Similarity:147/375 - (39%) Gaps:115/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYLL---CVLILSGGSLLSTAQSNKLDLVYKKAESMV--------SSLKIR-------------- 42
            |:||   ||.:.|.|||.....|   |:.:|..|.:|        .:||:|              
  Fly     7 LFLLAWSCVFLGSTGSLNRIGNS---DIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVV 68

  Fly    43 ------------------------------LEELKQSY--------------------------- 50
                                          ||.|.|..                           
  Fly    69 LLADAVVQVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLP 133

  Fly    51 KEITEERGSHET--INP--SSC--LAAGINSNGIHVIEVP-----GLEPFPVYCDTRLAGSGWTV 104
            ||:|||:...:.  ..|  |.|  |..|:..:|::...||     ..:.:..||.....|..|||
  Fly   134 KELTEEKDEPKVDFYQPAKSDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTV 198

  Fly   105 IQRRQ---DGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDAR 166
            ||.|.   |..|||.|.|:||..|||.||.:|:.|.|..|.:...:.:||.:.:::....:..|.
  Fly   199 IQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAE 263

  Fly   167 YEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFDH--------DDTGHGCARIYVGAW 223
            |..|.:.:.|.:|.|||.|::.|...|:|..|..|.|||:|.        |.|   |...|.|.|
  Fly   264 YPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADST---CGEDYGGGW 325

  Fly   224 WYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            |:|:|.:.||||::....|..|     .|.||:||......|..:|||||
  Fly   326 WFDRCTQCNLNGEHGVHQRASP-----AIIWMNWRTGTDKPKSSRMMIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 80/231 (35%)
CG9593NP_650493.2 FReD 150..371 CDD:238040 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446488
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.