DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and CG7668

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:131/276 - (47%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYK----------EITEERGSHETINPSSCLA 70
            :|::.::....|.:|..||     |:::.:|:.:.|          ||..|...:...:....|.
  Fly   169 ILNSKEAEIARLEFKIDES-----KLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLL 228

  Fly    71 AGINSNGIHVIEVPGLEPF-PVYCDTRLAGSGWTVIQRRQDGSENFYRCWE-EYSQGFGELSGEF 133
            .......|.::.:|..||| .|:.|...||.||.:||||.|||  |....| ....|.|:|.|||
  Fly   229 GSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGS--FDNATESNIITGCGDLGGEF 291

  Fly   134 FMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYH 198
            ::||:|||.:||....||::.:.||:.....|||::|.||:....|.|..||:|||:|||:.|.|
  Fly   292 WLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSH 356

  Fly   199 -----KGMPFSTFDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWR 258
                 .|.||:             :....||  .....||||:| ...:.|...:. ||.|.:|.
  Fly   357 INHIIVGNPFA-------------MESSKWW--GTMNCNLNGKY-RNSKVELDTTD-GIWWGNWN 404

  Fly   259 -GYDYGYKFVQMMIRP 273
             |..|..|..:|:|||
  Fly   405 VGNRYPLKSCKMLIRP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 78/219 (36%)
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/47 (19%)
FReD 245..421 CDD:294064 75/195 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.