DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fga

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001181918.1 Gene:fga / 378986 ZFINID:ZDB-GENE-031010-21 Length:684 Species:Danio rerio


Alignment Length:220 Identity:84/220 - (38%)
Similarity:119/220 - (54%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NGIHVIEVPGLEP-FPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGEL----SGEFFM 135
            :|:..|:..|.|. ..||||......|||::|:|:|||.||.|.|:||..|||::    .||.::
Zfish   467 SGMFKIKPAGSEEVVEVYCDQSTGLGGWTLVQQREDGSVNFNRTWKEYLNGFGQIDKQGKGEIWI 531

  Fly   136 GLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL----- 195
            |.:.||.||..|.. |.|.::|:.|....|.| :..:|:.:..:.|:. ..|.|||||:|     
Zfish   532 GNKFLHLLTQKESL-LRVELQDWTGAEAYAEY-NIKVGSEAEGFPLTA-SDYDGDAGDALVRGHP 593

  Fly   196 -----RYHKGMPFSTFDHDDT--GHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMS----- 248
                 ..|.||.|||||.|..  ...||.:|.|.|||:.||.:||||.|.:||:::|...     
Zfish   594 NLGSFLSHAGMKFSTFDRDSDKWEENCAEMYGGGWWYNNCQSANLNGIYYKGGQYDPATKVPYEI 658

  Fly   249 GRGITWMSWRGYDYGYKFVQMMIRP 273
            ..|:.|:.::..||..|.|:|.|||
Zfish   659 ENGVVWLPFKPADYSLKVVRMKIRP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/220 (38%)
fgaNP_001181918.1 Fib_alpha 46..185 CDD:285864
FReD 453..684 CDD:238040 84/220 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.