DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and CG30280

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster


Alignment Length:277 Identity:131/277 - (47%)
Similarity:183/277 - (66%) Gaps:17/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCVLILSGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERG----SHETINPS 66
            |.|:|......|:.  ...|:.:|::||:.:|:|:..|.:|        |..|    |.:.|.|:
  Fly    14 LSVMIFCHAETLNL--FGNLEAIYEQAENALSTLQESLLQL--------ETNGTLNTSPDVIYPT 68

  Fly    67 SCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSG 131
            |||.:|...||:|.::||||.||.|||:.:|||.||.|||:|..|:.:|:|.|:||..|||.|..
  Fly    69 SCLTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMD 133

  Fly   132 EFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLR 196
            |:|:||||:..||..||:||:|::|||:..:..|::::|||||....||::.||||||.||||||
  Fly   134 EYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLR 198

  Fly   197 YHKGMPFSTFDHD---DTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWR 258
            .|:.|.|||:|.|   :....||..|:|.|||:.|..|||||||:.||::|..:..||:.|.|||
  Fly   199 SHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWR 263

  Fly   259 GYDYGYKFVQMMIRPKC 275
            |::|||:..||||||||
  Fly   264 GHNYGYRVTQMMIRPKC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 113/213 (53%)
CG30280NP_611641.6 FReD 65..279 CDD:238040 113/213 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446511
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 220 1.000 Inparanoid score I5953
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
1110.900

Return to query results.
Submit another query.