DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and tnr

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_919364.1 Gene:tnr / 369191 ZFINID:ZDB-GENE-030804-1 Length:1350 Species:Danio rerio


Alignment Length:281 Identity:103/281 - (36%)
Similarity:143/281 - (50%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVYKKAESMVSSL-------KIRLEELKQSYK---EITEERGSHETI--------------NPSS 67
            |.||.|:.....|       .||||.|.::.:   .:...||...::              .|.:
Zfish  1066 LTYKAADGSRKELILDAEDTWIRLEGLAETTEYTVRLQVARGLETSVIVSTSFTTGNRLFPTPQN 1130

  Fly    68 C---LAAGINSNGIHVIEV-----PGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQ 124
            |   |..|....||:.|.|     .|::   ||||....|.||.|.||||:|..:|.|.|.:|..
Zfish  1131 CAQHLLNGETLGGIYTIYVNRDLSQGVQ---VYCDMTTDGGGWIVFQRRQNGLTDFSRKWTDYKI 1192

  Fly   125 GFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSG 189
            |||.|..||::||:.:|.:.....|||.:.|:|....|: |.|:.|:||::.:.|.|.: |:|||
Zfish  1193 GFGSLEDEFWLGLDNIHKIAAQGRYELRIDMKDGQESVY-ANYDRFSIGDSKSLYKLRI-GEYSG 1255

  Fly   190 DAGDSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGI 252
            .|||||.||:..||||.|.|:  ....||..|.|||||..|.|:||||:|.|      ....:||
Zfish  1256 TAGDSLSYHQSRPFSTKDKDNDIAVTNCALSYKGAWWYKNCHRANLNGKYGE------SRHSQGI 1314

  Fly   253 TWMSWRGYDYGYKFVQMMIRP 273
            .|..|:|:::...||:|.:||
Zfish  1315 NWYHWKGHEFSIPFVEMKMRP 1335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 91/235 (39%)
tnrNP_919364.1 EGF_2 199..225 CDD:285248
EB 234..283 CDD:279949
EGF_2 294..318 CDD:285248
fn3 323..401 CDD:278470
fn3 411..490 CDD:278470
fn3 500..579 CDD:278470
FN3 590..674 CDD:238020
fn3 682..754 CDD:278470
fn3 771..849 CDD:278470
FN3 859..935 CDD:214495
fn3 949..1019 CDD:278470
fn3 1035..1103 CDD:278470 10/36 (28%)
FReD 1126..1336 CDD:238040 91/221 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.