DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and CG1889

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:328 Identity:105/328 - (32%)
Similarity:153/328 - (46%) Gaps:76/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSGGSL----LSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERG------------- 58
            |.||.|    |..|.|:...:      |.:|.|..|::.|......:.|:.|             
  Fly    24 LGGGLLVPPSLGNASSSSCPV------SALSGLTTRMQSLNNEIASVKEQIGSLQEQLVDLRRAG 82

  Fly    59 -------------------SHET-----------------INPSSCLAAGINSNG-IHVIEVPGL 86
                               ||.:                 |.|::||.   ..:| :.:.....:
  Fly    83 SAPVVGLASPNALASRFPFSHNSLDIEPQLLANGGAAAVPITPANCLK---QQHGVVRIRPRSNV 144

  Fly    87 EPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYEL 151
            |||.|:||.::...|||::..|.||||:|.|.|.:|..|||.|:.|||:||:|||.:|:::.|||
  Fly   145 EPFFVFCDQKVRNGGWTMVVNRYDGSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYEL 209

  Fly   152 FVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFD--HDDTGHG 214
            .|.:::....:..|.|:.|:||:.|..|.|:|||.|.|||.|:||.|.|..|||.|  :|:....
  Fly   210 LVQLQNRKQELRYALYDHFSIGSESEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDENEQN 274

  Fly   215 CARIYVGAWWY-DQCQRSNLNGQYLEGGRFEPKMSG-RGITWMSWRGYDYG----YKFVQMMIRP 273
            ||....||:|| ..|..:|..|.|..  ..|..:.| :||.   |||:..|    .|.|:||:||
  Fly   275 CAAQQSGAFWYGGSCNLTNPFGLYQR--LLERDVDGFKGIL---WRGFLNGPKGSLKIVRMMVRP 334

  Fly   274 KCS 276
            :.:
  Fly   335 RAA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 88/219 (40%)
CG1889NP_727376.2 Lzipper-MIP1 <34..80 CDD:291087 10/51 (20%)
FReD 123..335 CDD:238040 88/219 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.