DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl3

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_038941.1 Gene:Angptl3 / 30924 MGIID:1353627 Length:455 Species:Mus musculus


Alignment Length:288 Identity:84/288 - (29%)
Similarity:138/288 - (47%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ESMVSSLKIRLEELKQSYKEITEERGS------------------------------------HE 61
            |...:|::..|:.:::.||:::::...                                    :|
Mouse   169 EQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRAPRTTPPLQLNE 233

  Fly    62 TIN------PSSCLAA---GINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYR 117
            |.|      |:.|.|.   |.:::|::.|:....:.|.|||||: :||.||:||.|:|||::|..
Mouse   234 TENTEQDDLPADCSAVYNRGEHTSGVYTIKPRNSQGFNVYCDTQ-SGSPWTLIQHRKDGSQDFNE 297

  Fly   118 CWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALS 182
            .||.|.:|||.|.|||::||||::.:.....|.|.:.::|:....|...| .|.:|:...:|.|.
Mouse   298 TWENYEKGFGRLDGEFWLGLEKIYAIVQQSNYILRLELQDWKDSKHYVEY-SFHLGSHETNYTLH 361

  Fly   183 VLGKYSGDAGDSLRYHKGMPFSTFDHDDTGH-GCARIYVGAWWY-DQCQRSNLNGQYLEGGRFEP 245
            | .:.:|:...:|..|..:.|||::|...|. .|...|.|.||: |.|..:||||:|.:......
Mouse   362 V-AEIAGNIPGALPEHTDLMFSTWNHRAKGQLYCPESYSGGWWWNDICGENNLNGKYNKPRTKSR 425

  Fly   246 KMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ....|||.|.......|..|..:||::|
Mouse   426 PERRRGIYWRPQSRKLYAIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 77/222 (35%)
Angptl3NP_038941.1 Sufficient to inhibit LIPG/EL phospholipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 17..207 5/37 (14%)
Sufficient to inhibit LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1, ECO:0000269|PubMed:20581395 17..165
Required for inhibition of LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 32..56
SPEC <34..191 CDD:295325 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..242 3/39 (8%)
FReD 241..453 CDD:238040 75/214 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.