DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and tnn

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:238 Identity:84/238 - (35%)
Similarity:123/238 - (51%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSCLAAGINSN---GIHVIEVPG--LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQ 124
            |..|.....|.|   |::.|.|..  .....||||.:..|.||.|.|||..|..:|.:.|.:|.:
Zfish   794 PMDCTQIMRNGNMESGVYTIYVNNNRSRTMQVYCDMKTDGGGWIVFQRRNTGKVDFMKKWRDYMK 858

  Fly   125 GFGELSGEFFMGLEKLHFLT-TAEPYELFVYMEDFNGVVHD---ARYEDFAIGNASASYALSVLG 185
            |||||:.||::||:|:|.|| |...||....:    |...|   |.|::|.:..:...:.|:: |
Zfish   859 GFGELTEEFWLGLDKIHELTNTPTQYEARFDL----GSGSDRKYAVYDNFKVAPSKQKFKLTI-G 918

  Fly   186 KYSGDAGDSLRYHKGMPFSTFDHD-DTGHG-CARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMS 248
            .|.|:|||::.||:|.||||.|.| |...| ||..:.|||||..|..:|||      |||.....
Zfish   919 SYKGNAGDAMTYHQGAPFSTVDSDNDIALGNCALTHQGAWWYKNCHLANLN------GRFGDNRH 977

  Fly   249 GRGITWMSWRGYDYGYKFVQMMIRPKCSNNLRRQGMQNALNAH 291
            ..|:.|..|:|:.....|.::.|||..:...:::.::..:.|:
Zfish   978 SMGVNWEPWKGHLQSLDFAEIKIRPVGAAGRQKRSLKRRVAAY 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 82/219 (37%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470
FReD 792..1003 CDD:238040 82/219 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.