DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and tncb

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001299845.1 Gene:tncb / 30037 ZFINID:ZDB-GENE-980526-104 Length:1811 Species:Danio rerio


Alignment Length:264 Identity:96/264 - (36%)
Similarity:141/264 - (53%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 STAQSNKLDLVY-KKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGIN---SNGI 78
            ||..:.||..:. .|...::|::.:.:..|   ||            :|..|..|.:|   ::|:
Zfish  1558 STEYTVKLQAIAGPKRSRVISTVFLTIGVL---YK------------HPKDCSQALLNGDTTSGL 1607

  Fly    79 HVIEVPGLE--PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLH 141
            :.|.:.|.|  |..||||....|.||.|..|||.|...|:|.|:.|:.|||:|:.||::||..||
Zfish  1608 YTIYLRGDESQPLQVYCDMTTDGGGWIVFVRRQSGKVEFFRNWKNYTAGFGDLNDEFWLGLSNLH 1672

  Fly   142 FLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTF 206
            .:|:...|||.|.:.| .|....|:|:.|:|....|.|.:.| |.|||.||||:.||.|.||||:
Zfish  1673 KITSFGQYELRVDLRD-KGESAYAQYDKFSISEPRARYKVHV-GGYSGTAGDSMTYHHGRPFSTY 1735

  Fly   207 DHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQM 269
            |:|:  ....||..|.||:||..|.|.|:.|:|.:...      .:|:.|..|:|:::..:|.:|
Zfish  1736 DNDNDIAVTNCALSYKGAFWYKNCHRVNIMGRYGDNSH------SKGVNWFHWKGHEHSVEFAEM 1794

  Fly   270 MIRP 273
            .|||
Zfish  1795 KIRP 1798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/218 (40%)
tncbNP_001299845.1 DnaJ <471..>544 CDD:333066
fn3 689..760 CDD:306538
fn3 778..858 CDD:306538
fn3 868..948 CDD:306538
FN3 958..1047 CDD:238020
fn3 1050..1128 CDD:306538
fn3 1140..1215 CDD:306538
fn3 1231..1303 CDD:306538
fn3 1323..1400 CDD:306538
fn3 1410..1482 CDD:306538
fn3 1498..1570 CDD:306538 4/11 (36%)
FReD 1589..1798 CDD:238040 86/228 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.