DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angpt4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:137/271 - (50%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGGSLLSTAQSNKLDLVYKKAESMVSSL-KIRLEELKQSYKEITEERGSHETINPSSCLAAGINS 75
            |..|.|...|...::||.:....:.... .:.|:..|..:::..|.:.|            |.|:
  Rat   254 SNSSSLQQQQQQLMELVQRLVRIVAQDQHPVSLKTPKPLFRDCAEIKRS------------GANT 306

  Fly    76 NGIHVIEVPGL-EPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEK 139
            :|::.|....: :|..|:||....|.|||:||||:|||.||.|.||||.:|||.::.|.::|.|.
  Rat   307 SGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGNVAREHWLGNEA 371

  Fly   140 LHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYH-----K 199
            :|.||:...|.|.|.:.|:.|.....:||:|.:|:....|:|||     .|:..|.|..     :
  Rat   372 VHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLSV-----NDSSISARLKNSLAPQ 431

  Fly   200 GMPFST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDY 262
            |..|||  .|:|:....||::..|.||:|.|..|||||.|....:...|::  ||.|..:||..|
  Rat   432 GTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYPVHQHLHKIN--GIRWHYFRGPSY 494

  Fly   263 GYKFVQMMIRP 273
            .....:||:||
  Rat   495 SLHGTRMMLRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 81/219 (37%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.