DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Mfap4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_006246622.1 Gene:Mfap4 / 287382 RGDID:1307841 Length:281 Species:Rattus norvegicus


Alignment Length:248 Identity:90/248 - (36%)
Similarity:116/248 - (46%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SCL----------AAGINSNGIHVIEVPGLE-PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWE 120
            |||          ..|...:|:::|...|.. |.||:||....|..|||.|:|.:||.:|:|.|.
  Rat    35 SCLQQPLDCDDIYMQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWN 99

  Fly   121 EYSQGFGELSGEF------------------------FMGLEKLHFLTTAEPYELFVYMEDFNGV 161
            :|..|||...||:                        ::||:.||.||..:.|||.|.:|||...
  Rat   100 DYKLGFGRADGEYWLGKVGSWGGGCPLANSWLTSCHPYLGLQNLHLLTLKQKYELRVDLEDFENN 164

  Fly   162 VHDARYEDFAIGNASAS-----YALSVLGKYSGDAGDSLRYHKGMPFSTFDHDDT--GHGCARIY 219
            ...|:|.||:|...:.|     |.|.|.|...|.|||||.||.|..|||||.|..  ...||.:.
  Rat   165 TAYAKYVDFSISPNAVSAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALS 229

  Fly   220 VGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIR 272
            .||:|:..|..:||||.||.|....   ...||.|..|:|:.|..|..:|.||
  Rat   230 SGAFWFRSCHFANLNGFYLGGSHLS---YANGINWAQWKGFYYSLKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 90/248 (36%)
Mfap4XP_006246622.1 FReD 38..280 CDD:238040 87/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.