DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ANGPT1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001137.2 Gene:ANGPT1 / 284 HGNCID:484 Length:498 Species:Homo sapiens


Alignment Length:225 Identity:86/225 - (38%)
Similarity:124/225 - (55%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GSHETINP----SSCLAAGINSNGIHVIEVPGL-EPFPVYCDTRLAGSGWTVIQRRQDGSENFYR 117
            |..|...|    :....||.|.:||:.|.:..: ||..|:|:..:.|.||||||.|:|||.:|.|
Human   275 GKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQR 339

  Fly   118 CWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALS 182
            .|:||..|||..|||:::|.|.:..:|:...|.|.:.:.|:.|....::|:.|.|||...:|.|.
Human   340 GWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLY 404

  Fly   183 VLGKYSGDAG--DSLRYHKGMPFST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRF 243
            :.| ::|.||  .||..| |..|||  .|:|:....||.:..|.||:|.|..|||||.:...|:.
Human   405 LKG-HTGTAGKQSSLILH-GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQN 467

  Fly   244 EPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..|::  ||.|..::|..|..:...|||||
Human   468 HGKLN--GIKWHYFKGPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/220 (38%)
ANGPT1NP_001137.2 Smc <81..280 CDD:224117 2/4 (50%)
FReD 281..496 CDD:238040 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.