DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_036053.2 Gene:Angptl2 / 26360 MGIID:1347002 Length:493 Species:Mus musculus


Alignment Length:223 Identity:95/223 - (42%)
Similarity:126/223 - (56%) Gaps:14/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TINPS----SCLAA---GINSNGIHVIEVPGLEP-FPVYCDTRLAGSGWTVIQRRQDGSENFYRC 118
            |..||    .||.|   |.:::.|::::...... ..|:||.|....||||||||.|||.||:|.
Mouse   268 TDKPSGPWRDCLQALEDGHSTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRN 332

  Fly   119 WEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSV 183
            ||.|.||||.:.||:::|||.:::||....|:|.|.|||::|....|.|..|.:...|..|.|. 
Mouse   333 WETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLR- 396

  Fly   184 LGKYSGDAGDSLRYHKGMPFSTFDHDD---TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEP 245
            ||:|.|:||||..:|.|..|:|.|.|.   ||: ||....|.|||:.|..|||||.:..||.:..
Mouse   397 LGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGN-CAHYQKGGWWYNACAHSNLNGVWYRGGHYRS 460

  Fly   246 KMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            :... |:.|..:||..|..|.|.|||||
Mouse   461 RYQD-GVYWAEFRGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 94/222 (42%)
Angptl2NP_036053.2 t_SNARE 156..>206 CDD:197699
FReD 273..487 CDD:238040 90/216 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.