DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fgl1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:278 Identity:97/278 - (34%)
Similarity:143/278 - (51%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEE------RGSHETINPSSCLAAGINSNGI 78
            ||..:|:...|:.:.:::.|   |.|.:..:.:..:|      .|.....:.|.....|...:|.
  Rat    37 AQVRQLETRVKQQQVVIAQL---LHEKEVQFLDRGQEDSFIDLGGKRHYADCSEIYNDGFKHSGF 98

  Fly    79 HVIE-VPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFG---ELSGEFFMGLEK 139
            :.|: :..|..|.||||.. .|.||||||||.||||||.|.|.:|..|||   :.:||:::|.:.
  Rat    99 YKIKPLQSLAEFSVYCDMS-DGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGEYWLGNKN 162

  Fly   140 LHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL--------- 195
            ::.||....|.|.:.:.||......|:||.|.:|:..:.|.|:: |:|||.|||||         
  Rat   163 INLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYELNI-GEYSGTAGDSLSGTFHPEVQ 226

  Fly   196 --RYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEGG-RFEPKMSGRGITWM 255
              ..|:.|.|||.|.|:..:  .||......||:::|..:||||.|.:|. |.|   :..|:.|.
  Rat   227 WWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYRAE---TDNGVVWY 288

  Fly   256 SWRGYDYGYKFVQMMIRP 273
            :|||:.|..|.|.|.|||
  Rat   289 TWRGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 88/229 (38%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.