DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fgb

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_038957639.1 Gene:Fgb / 24366 RGDID:2604 Length:504 Species:Rattus norvegicus


Alignment Length:286 Identity:89/286 - (31%)
Similarity:140/286 - (48%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAG------INSNG--- 77
            ::.:.|..:...|::..|:.::::|:......||...:..|:|.:..:.:|      |...|   
  Rat   176 NDNIPLNLRVLRSILEDLRSKIQKLESDISAQTEYCHTPCTVNCNIPVVSGKECEEIIRKGGETS 240

  Fly    78 -IHVIEV-PGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE------------ 128
             :::|:. ...:|:.||||.:....||||||.|||||.:|.|.|:.|.:|||.            
  Rat   241 EMYLIQPDTSSKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDTKKYCG 305

  Fly   129 LSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGD 193
            |.||:::|.:|:..||...|.||.:.|||:.|....|.|..|.:...:..|.:|| .||.|.||:
  Rat   306 LPGEYWLGNDKISQLTRIGPTELLIEMEDWKGDKVKAHYGGFTVQTEANKYQVSV-NKYKGTAGN 369

  Fly   194 SL--------------RYHKGMPFSTFDHDDTG-------HGCARIYVGAWWYDQCQRSNLNGQY 237
            :|              ..|.||.|||:|.|:.|       ..|::...|.|||::|..:|.||:|
  Rat   370 ALMEGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRY 434

  Fly   238 LEGGRFEPKMSGR----GITWMSWRG 259
            ..||.:...||..    |:.||:|:|
  Rat   435 YWGGLYSWDMSKHGTDDGVVWMNWKG 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 82/245 (33%)
FgbXP_038957639.1 Fib_alpha 80..222 CDD:400857 8/45 (18%)
FReD 225..462 CDD:412152 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.