DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:264 Identity:101/264 - (38%)
Similarity:143/264 - (54%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YKKAESMVSSLKIRLEELKQSYKEITEERGSHETIN--PSS----------CLAA---GINSNGI 78
            |.:..:.:|:.:|:.:   |:.|.:.....:..|:.  |||          ||.|   |.:::.|
Human   230 YNRIINQISTNEIQSD---QNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSI 291

  Fly    79 HVIEVPGLEP-FPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHF 142
            ::::...... ..|:||.|....||||||||.|||.||:|.||.|.||||.:.||:::|||.:::
Human   292 YLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYW 356

  Fly   143 LTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFD 207
            ||....|:|.|.|||::|....|.|..|.:...|..|.|. ||:|.|:||||..:|.|..|:|.|
Human   357 LTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHGNAGDSFTWHNGKQFTTLD 420

  Fly   208 HDD---TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQM 269
            .|.   ||: ||....|.|||:.|..|||||.:..||.:..:... |:.|..:||..|..|.|.|
Human   421 RDHDVYTGN-CAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQD-GVYWAEFRGGSYSLKKVVM 483

  Fly   270 MIRP 273
            ||||
Human   484 MIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 95/230 (41%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 90/216 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.