DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and FGB

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:291 Identity:91/291 - (31%)
Similarity:144/291 - (49%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SMVSSLKIRLEELKQSYKEITEERGSHETINPSSC-------------LAAGINSNGIHVIEV-P 84
            |::.:|:.::::|:   .:::.:.....|....||             :..|..::.:::|:. .
Human   200 SILENLRSKIQKLE---SDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDS 261

  Fly    85 GLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE------------LSGEFFMGL 137
            .::|:.||||......||||||.|||||.:|.|.|:.|.||||.            |.||:::|.
Human   262 SVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGN 326

  Fly   138 EKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL------- 195
            :|:..||...|.||.:.|||:.|....|.|..|.:.|.:..|.:|| .||.|.||::|       
Human   327 DKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISV-NKYRGTAGNALMDGASQL 390

  Fly   196 -------RYHKGMPFSTFDHDDTG-------HGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPK 246
                   ..|.||.|||:|.|:.|       ..|::...|.|||::|..:|.||:|..||::...
Human   391 MGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWD 455

  Fly   247 MSGR----GITWMSWRGYDYGYKFVQMMIRP 273
            |:..    |:.||:|:|..|..:.:.|.|||
Human   456 MAKHGTDDGVVWMNWKGSWYSMRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/262 (33%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 6/36 (17%)
FReD 237..486 CDD:294064 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.