DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and FCN2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:218 Identity:96/218 - (44%)
Similarity:120/218 - (55%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGF 126
            |.:|   |..|...:|.|.|.:|...|..|.||....|.||||.|||.|||.:|||.|..|.|||
Human   102 PRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGF 166

  Fly   127 GELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKY-SGD 190
            |...|||::|.:.:|.||.....||.|.:.||......|:|..|.:.:.:..|.| |||.: .|.
Human   167 GSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNL-VLGAFVEGS 230

  Fly   191 AGDSLRYHKGMPFSTFDHD---DTGHGCARIYVGAWWYDQCQRSNLNGQYLEG--GRFEPKMSGR 250
            |||||.:|....|||.|.|   :||: ||.::.|||||..|..|||||:||.|  |.|     ..
Human   231 AGDSLTFHNNQSFSTKDQDNDLNTGN-CAVMFQGAWWYKNCHVSNLNGRYLRGTHGSF-----AN 289

  Fly   251 GITWMSWRGYDYGYKFVQMMIRP 273
            ||.|.|.:||:|.||..:|.:||
Human   290 GINWKSGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 96/218 (44%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99
FReD 102..312 CDD:238040 94/216 (44%)