DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and FCN1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens


Alignment Length:216 Identity:93/216 - (43%)
Similarity:116/216 - (53%) Gaps:12/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGF 126
            |.:|   |..|...:|.|.|.:|...|..|.||....|.||||.|||.|||.:|||.|..|.|||
Human   115 PRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGF 179

  Fly   127 GELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKY-SGD 190
            |...|||::|.:.:|.||.....||.|.:.||.|....|:|:.|.:.:.:..|.| |||.: .|.
Human   180 GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKL-VLGAFVGGS 243

  Fly   191 AGDSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMS-GRGI 252
            ||:||..|....|||.|.|:  :...||..:.|||||..|..|||||.||.|    |..| ..||
Human   244 AGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMG----PHESYANGI 304

  Fly   253 TWMSWRGYDYGYKFVQMMIRP 273
            .|.:.:||.|.||..:|.:||
Human   305 NWSAAKGYKYSYKVSEMKVRP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 93/216 (43%)
FCN1NP_001994.2 Collagen 51..107 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111
FReD 115..325 CDD:238040 91/214 (43%)
A domain, contributes to trimerization 115..154 13/38 (34%)
B domain, contributes to trimerization 155..243 39/88 (44%)
Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 282..284 0/1 (0%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.