DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ensh-1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001024508.1 Gene:ensh-1 / 181135 WormBaseID:WBGene00017013 Length:465 Species:Caenorhabditis elegans


Alignment Length:304 Identity:78/304 - (25%)
Similarity:121/304 - (39%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YKKAESMVSSLKIRLEELKQSYKEITEERGSHE-----TINP----------------------- 65
            |...|..|...:..|||..:.::..|.|..:.|     |..|                       
 Worm   150 YDTTEPFVEEEEYHLEEATEHHEIATIEATTPEPSEIATKKPIIYYSPPTTPKTTTSTGYLQFYD 214

  Fly    66 -------SSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYR-CW 119
                   .:|   ||.| :.:|::.|:  .:|.|..:||......||||||||.||..:|:| ..
 Worm   215 SIDGDASDNCLERLALG-SPSGVYSIQ--SVEKFQAFCDMDTTTGGWTVIQRRVDGDGSFHRGTM 276

  Fly   120 EEYSQGFGELSGEFFMGLEKLHFLTT--AEPYELFVYMEDFNGVVHD----ARYEDFAIGNASAS 178
            :::.:|||.|.|..::||||||.|..  |.|..|.:   :..|...|    .|:.:..:|....:
 Worm   277 KKFVEGFGNLQGSHWLGLEKLHNLAPIGATPAILRI---EIQGETCDLTCSKRFANTWVGEWKVN 338

  Fly   179 -------YALSV----LGKYSGDAGDSLRYHKGMPFSTFDHD---DTGHGCARI-YVGAWWYDQ- 227
                   |.:.:    :|..:.:..|......|..|||.|:|   :|...||:. .||.||:.: 
 Worm   339 FGKKQDGYKIQITEEGVGNLTYNGVDPFFGANGRRFSTNDNDQDENTFMNCAQFRMVGPWWHPKS 403

  Fly   228 CQRSNLNGQY-LEGGRFEPK----MSGRGITW----MSWRGYDY 262
            |....|||.: ....:::.|    .:.|...|    ..:.||.|
 Worm   404 CSDVGLNGYFQTTSEKYDVKDRNQNAKRYFVWAFDKQIYNGYPY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 68/265 (26%)
ensh-1NP_001024508.1 FBG 220..460 CDD:214548 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14144
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.