DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:243 Identity:72/243 - (29%)
Similarity:102/243 - (41%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSCL-AAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSE--NFYRCWEEYSQGF 126
            |..|. .:.:.|:|:..| .|...|..|||||...|: :||||.|....|  ||...:::|:...
 Worm   195 PMDCSEISNLTSSGVQTI-YPNGSPVQVYCDTTSYGT-YTVIQSRGATGENVNFNITYDKYTDII 257

  Fly   127 GELSGE--FFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSG 189
            |....|  |:.||:.::.|:.|:||.|.:.:.....:|....|..|.:|.|...|.|:.....||
 Worm   258 GTPGKETNFWFGLDNMNHLSGAKPYRLQIDLCCGTLLVAKQIYHSFKVGTAEYGYNLTATADISG 322

  Fly   190 D--AGDSLRYHKGMPFSTFDH----------------DDTGHGCARIYVGAWWYDQCQRSNLNGQ 236
            .  |..|.....|..|||||:                ||:|.. ::.| |.|||..| .:||||.
 Worm   323 IGLAYSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYFDDSGVQ-SQPY-GGWWYGSC-GNNLNGF 384

  Fly   237 YLEGGRFEPKMSGR--------------GITWMSWRGYDYGYKFVQMM 270
            :.      ||.:|.              ||...:..|..||...|.|:
 Worm   385 WY------PKRNGNCTVPDEVFKNTTMLGINMRTTSGQGYGGYNVDMV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 72/243 (30%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.