Sequence 1: | NP_726164.1 | Gene: | CG30281 / 246525 | FlyBaseID: | FBgn0050281 | Length: | 291 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501481.2 | Gene: | C49C8.5 / 177668 | WormBaseID: | WBGene00016769 | Length: | 451 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 62/202 - (30%) |
---|---|---|---|
Similarity: | 92/202 - (45%) | Gaps: | 39/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 PSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRR-QDGSE-NFYRCWEEYSQGFG 127
Fly 128 ELSG---EFFMGLEKLHFLTT-AEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSV----- 183
Fly 184 -LG-KYSGDAGDSLRYHKGMPFST------------------FDHDDTGHGCARIYVGAWWYDQC 228
Fly 229 QRSNLNG 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30281 | NP_726164.1 | FReD | 63..274 | CDD:238040 | 62/202 (31%) |
C49C8.5 | NP_501481.2 | FReD | 190..437 | CDD:294064 | 62/202 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |