DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and C49C8.5

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_501481.2 Gene:C49C8.5 / 177668 WormBaseID:WBGene00016769 Length:451 Species:Caenorhabditis elegans


Alignment Length:202 Identity:62/202 - (30%)
Similarity:92/202 - (45%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRR-QDGSE-NFYRCWEEYSQGFG 127
            ||.|......|:|:..|...|..|..||||.:.:...:|:||.| ::||. .|...:..||..||
 Worm   191 PSDCDEVESTSSGLQTIYPDGSTPVSVYCDRKNSAGAYTIIQSRGREGSNITFDIPFANYSDWFG 255

  Fly   128 ELSG---EFFMGLEKLHFLTT-AEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSV----- 183
            | ||   .|::||:.::.|:| .:.|.|.:.:.....::....|.:|.:...:..|||:.     
 Worm   256 E-SGVGKNFWLGLDNMNNLSTNGKTYSLQIDLCCGTQLMAKQLYTNFKVATKAEQYALTASADLP 319

  Fly   184 -LG-KYSGDAGDSLRYHKGMPFST------------------FDHDDTGHGCARIYVGAWWYDQC 228
             :| .||..|.|     .|.||||                  :|.|:.|.|.::.| |.|||..|
 Worm   320 GIGLDYSSSAKD-----LGAPFSTQLTYSLPKGKAECDQFEFYDDDNGGAGPSKGY-GGWWYGSC 378

  Fly   229 QRSNLNG 235
             .:||||
 Worm   379 -GNNLNG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 62/202 (31%)
C49C8.5NP_501481.2 FReD 190..437 CDD:294064 62/202 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.