DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fgl2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_032039.2 Gene:Fgl2 / 14190 MGIID:103266 Length:432 Species:Mus musculus


Alignment Length:332 Identity:103/332 - (31%)
Similarity:147/332 - (44%) Gaps:82/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETI------------- 63
            :||:...||:.:::    ::.||.|:.|.   .|||.:..:|...:|..||:             
Mouse   110 NGGNGAETAEDSRV----QELESQVNKLS---SELKNAKDQIQGLQGRLETLHLVNMNNIENYVD 167

  Fly    64 NPSSCLAAGINSNGIHVIEVPGLE--------------------------------------PFP 90
            |..:.|...:||......:.|..|                                      .|.
Mouse   168 NKVANLTVVVNSLDGKCSKCPSQEHMQSQPVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFE 232

  Fly    91 VYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYM 155
            ||||....|.||||:|.|.|||.||.|.|::|..|||.|..||::|.:|:|.||.::...|.:.:
Mouse   233 VYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDL 297

  Fly   156 EDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRY-----HKGMPFSTFDHDDTGH-- 213
            |||||:...|.|:.|.:.|....|.|.: |.|:|.|||:||:     |....|:|.|.|:..:  
Mouse   298 EDFNGLTLYALYDQFYVANEFLKYRLHI-GNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPS 361

  Fly   214 -GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--RGITWMSW--------RGYDYGYKFV 267
             .|...|...||:|.|..:||||:|     :..|..|  .||.|.:|        .||...:|..
Mouse   362 GNCGLYYSSGWWFDSCLSANLNGKY-----YHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQA 421

  Fly   268 QMMIRPK 274
            :||||||
Mouse   422 KMMIRPK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 86/279 (31%)
Fgl2NP_032039.2 Uds1 72..151 CDD:292096 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 4/11 (36%)
Fibrinogen_C 202..428 CDD:278572 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.