DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fga

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus


Alignment Length:286 Identity:105/286 - (36%)
Similarity:146/286 - (51%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AESMVSSLKIRLEELKQSYKEITEERGSH-----ETINPSSCLA----------------AGINS 75
            :.|..|::|   :::.::|| :.:|.||.     ||.|.....|                :|. .
Mouse   508 SSSKTSTVK---KQVTKTYK-MADEAGSEAHREGETRNTKRGRARARPTRDCDDVLQTQTSGA-Q 567

  Fly    76 NGIHVIEVPG-LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELS----GEFFM 135
            |||..|:.|| .:.|.||||...:..||.:||:|.|||.||.|.|::|.:|||.|:    |||::
Mouse   568 NGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWL 632

  Fly   136 GLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL----- 195
            |.:.||.||..... |.|.:||:.|....|.|. |.:|:.:..|||.| ..|.|.|||:|     
Mouse   633 GNDYLHLLTLRGSV-LRVELEDWAGKEAYAEYH-FRVGSEAEGYALQV-SSYRGTAGDALVQGSV 694

  Fly   196 ----RY--HKGMPFSTFDH--DDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--- 249
                .|  |..|.|||||.  |.....||.:|.|.|||:.||.:||||.|..||.::|:.:.   
Mouse   695 EEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYE 759

  Fly   250 --RGITWMSWRGYDYGYKFVQMMIRP 273
              .|:.|:.:||.||..:.|:|.|||
Mouse   760 IENGVVWVPFRGADYSLRAVRMKIRP 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 95/250 (38%)
FgaNP_001104518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
Fibrinogen_aC 392..457 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555 7/28 (25%)
FReD 550..786 CDD:238040 93/240 (39%)
Fib_alpha 51..190 CDD:285864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.