DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fcna

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:231 Identity:94/231 - (40%)
Similarity:126/231 - (54%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KEITE---ERGSHETINPSSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQ 109
            ||:.:   :||      |.||   |..||...|.:.|.:|...|..|.||..:.|.||||.|||.
Mouse   112 KELGDTLCQRG------PRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRV 170

  Fly   110 DGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGN 174
            |||.:|:|.|:.|.:|||.|..||::|.:.||.||.....||.|.::||.|....|:|..|.:..
Mouse   171 DGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSE 235

  Fly   175 ASASYALSVLGKY-SGDAGDSLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQ 236
            ....|.|: ||:: .|.|||||..|..|.|:|.|.|:..:  .||.::.|||||..|.:|||||:
Mouse   236 EQEKYKLT-LGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGR 299

  Fly   237 YLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIR 272
            ||.|..   :....||.|.:.:|:.|.||..:|.||
Mouse   300 YLSGSH---ESYADGINWGTGQGHHYSYKVAEMKIR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 90/216 (42%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117 2/4 (50%)
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 88/212 (42%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 14/38 (37%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 37/88 (42%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43211
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.