DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angpt4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_033771.1 Gene:Angpt4 / 11602 MGIID:1336887 Length:509 Species:Mus musculus


Alignment Length:291 Identity:99/291 - (34%)
Similarity:148/291 - (50%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESM-------VSSLKIRL-------EELKQSYKEITE---------ERGSH- 60
            ||.|.|....::..|:       :::||..|       ..|:|..:::||         .:..| 
Mouse   220 AQLNSLQEKREQLHSLLGHQTGTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQDQHP 284

  Fly    61 ---ETINP--SSCL---AAGINSNGIHVI-EVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFY 116
               :|..|  ..|.   .:|:|::|::.| |....:|..|:||....|.|||:||.|:|||.||.
Mouse   285 VSLKTPKPVFQDCAEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVNFQ 349

  Fly   117 RCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYAL 181
            |.||||.:|||.::.|.::|.|.:|.||:...|.|.|.:.|:.|.....:||:|.:|:....|:|
Mouse   350 RTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRYSL 414

  Fly   182 SVLGKYSGDAG--DSLRYHKGMPFST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGR 242
            || ...|..||  :||. .:|..|||  .|:|:....||::..|.||:|.|..|||||.|....:
Mouse   415 SV-NDSSSSAGRKNSLA-PQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYSVHQ 477

  Fly   243 FEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ...|::  ||.|..:||..|.....:||:||
Mouse   478 HLHKIN--GIRWHYFRGPSYSLHGTRMMLRP 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 85/221 (38%)
Angpt4NP_033771.1 BMFP 140..217 CDD:294701
FReD 292..507 CDD:238040 85/219 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..436 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.