DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angpt1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_033770.2 Gene:Angpt1 / 11600 MGIID:108448 Length:498 Species:Mus musculus


Alignment Length:296 Identity:95/296 - (32%)
Similarity:140/296 - (47%) Gaps:48/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEER------------------------ 57
            |.|.:..|.:|     :.:||.....::||::.....|...                        
Mouse   209 LDTLKEEKENL-----QGLVSRQTFIIQELEKQLSRATNNNSILQKQQLELMDTVHNLISLCTKE 268

  Fly    58 ------GSHETINP----SSCLAAGINSNGIHVIEVPGL-EPFPVYCDTRLAGSGWTVIQRRQDG 111
                  |..|...|    :....||.|.:||:.|....: ||..|:|:..:.|.||||||.|:||
Mouse   269 GVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDG 333

  Fly   112 SENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNAS 176
            |.:|.|.|:||..|||..|||:::|.|.:..:|:...|.|.:.:.|:.|....::|:.|.|||..
Mouse   334 SLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEK 398

  Fly   177 ASYALSVLGKYSGDAG--DSLRYHKGMPFST--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQY 237
            .:|.|.:.| ::|.||  .||..| |..|||  .|:|:....||.:..|.||:|.|..|||||.:
Mouse   399 QNYRLYLKG-HTGTAGKQSSLILH-GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMF 461

  Fly   238 LEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ...|:...|::  ||.|..::|..|..:...|||||
Mouse   462 YTAGQNHGKLN--GIKWHYFKGPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/220 (38%)
Angpt1NP_033770.2 RILP-like <133..238 CDD:304877 8/33 (24%)
FReD 281..496 CDD:238040 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.