DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angptl3

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:293 Identity:96/293 - (32%)
Similarity:140/293 - (47%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEI----------------------TEERG 58
            ||.:.:.....|.|:|       :||:..|.|.:|...                      |....
Zfish   184 LLRSVKEQHDQLNYQK-------IKIKSLEDKVNYDTFQDTIEKPMDLNPETPDPFRYLTTNSTN 241

  Fly    59 SHETIN--PSSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRC 118
            ..:.||  |:.|   ...|..::||:.|:....|||.|||:....|:. ||||||:|||.:|.:.
Zfish   242 GTKDINDFPADCSEVFTRGQKTSGIYPIKPNQSEPFYVYCEITPDGAA-TVIQRREDGSVDFDQS 305

  Fly   119 WEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYED--FAIGNASASYAL 181
            ||:|..|||:|..||::||.|:|.:.....|.|.:.:||:.   .:.|:.:  |.:...::.|||
Zfish   306 WEKYEHGFGKLEKEFWLGLAKIHSIAQQGEYILHIELEDWK---EEKRFIEYTFTLEGPASDYAL 367

  Fly   182 SVLGKYSGDAGDSLRYHKGMPFSTFDHDDTGH---GCARIYVGAWWYDQCQRSNLNGQYL---EG 240
            . |...|||..|::..|.||.|||.|.|:..|   .|||.|.|.||:|.|..:||||:|.   ..
Zfish   368 H-LAPLSGDLSDAMSNHTGMKFSTKDRDNDNHDESNCARNYTGGWWFDACGDTNLNGRYAWMRSK 431

  Fly   241 GRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            .|.:.:   :||.|...:|..|..|..::.|||
Zfish   432 ARHQRR---KGIYWRPSKGSSYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 85/224 (38%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553 8/31 (26%)
FReD 248..461 CDD:238040 81/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.